Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species) EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2 |
Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries) Uniprot Q8J307 |
Domain d1wb3a1: 1wb3 A:180-271 [114464] Other proteins in same PDB: d1wb3a3, d1wb3a4, d1wb3b2, d1wb3b3, d1wb3c3, d1wb3c4, d1wb3d2, d1wb3d3 complexed with dxc, gnp, mg, so4 |
PDB Entry: 1wb3 (more details), 3.2 Å
SCOPe Domain Sequences for d1wb3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb3a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv meakagdrvgmaiqgvdakqiyrgciltskdt
Timeline for d1wb3a1: