Lineage for d1w85j_ (1w85 J:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908805Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 908806Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 908807Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)
  6. 908817Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)
  7. 908818Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
    Uniprot P11961 118-170
    Uniprot Q8VV74 128-169
  8. 908820Domain d1w85j_: 1w85 J: [114348]
    Other proteins in same PDB: d1w85a_, d1w85b1, d1w85b2, d1w85c_, d1w85d1, d1w85d2, d1w85e_, d1w85f1, d1w85f2, d1w85g_, d1w85h1, d1w85h2
    complexed with k, mg, peg, tdp

Details for d1w85j_

PDB Entry: 1w85 (more details), 2 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2
PDB Compounds: (J:) dihydrolipoyllysine-residue acetyltransferase component of pyruvate

SCOPe Domain Sequences for d1w85j_:

Sequence, based on SEQRES records: (download)

>d1w85j_ a.9.1.1 (J:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
viampsvrkyarekgvdirlvqgtgkngrvlkedidafl

Sequence, based on observed residues (ATOM records): (download)

>d1w85j_ a.9.1.1 (J:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
viampsvrkyarekgvdigtgkngrvlkedidafl

SCOPe Domain Coordinates for d1w85j_:

Click to download the PDB-style file with coordinates for d1w85j_.
(The format of our PDB-style files is described here.)

Timeline for d1w85j_: