SCOPe 2.05: Domain d1w74b_: 1w74 B:

Lineage for d1w74b_ (1w74 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117270] (1 PDB entry)
   Uniprot P65762

8. Domain d1w74b_: 1w74 B: [114312]

Details for d1w74b_

PDB Entry: 1w74, 2.6 Å

PDB Description: x-ray structure of peptidyl-prolyl cis-trans isomerase a, ppia, rv0009, from mycobacterium tuberculosis.

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1w74b_:

Sequence; same for both SEQRES and ATOM records:

>d1w74b_ b.62.1.1 (B:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]}
latatatlhtnrgdikialfgnhapktvanfvglaqgtkdystqnasggpsgpfydgavf
hrviqgfmiqggdptgtgrggpgykfadefhpelqfdkpyllamanagpgtngsqffitv
gktphlnrrhtifgevidaesqrvveaisktatdgndrptdpvviesitis

Timeline for d1w74b_:

• d1w74b_ first appeared in SCOP 1.71
  
• d1w74b_ appears in SCOPe 2.04
  
• d1w74b_ appears in SCOPe 2.06
  
• d1w74b_ appears in the current release, SCOPe 2.08