Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.273: YjbQ-like [111037] (1 superfamily) beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets |
Superfamily d.273.1: YjbQ-like [111038] (2 families) |
Family d.273.1.1: YjbQ-like [111039] (5 proteins) Pfam PF01894 |
Protein Hypothetical protein TM0723 [118034] (1 species) |
Species Thermotoga maritima [TaxId:2336] [118035] (1 PDB entry) Uniprot Q9WZI2 |
Domain d1vmja_: 1vmj A: [113679] Structural genomics target complexed with na, so4 |
PDB Entry: 1vmj (more details), 1.52 Å
SCOPe Domain Sequences for d1vmja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmja_ d.273.1.1 (A:) Hypothetical protein TM0723 {Thermotoga maritima [TaxId: 2336]} mksyrkelwfhtkrrrefinitplleecvresgikeglllcnamhitasvfinddepglh hdfevwleklapekpysqykhndtgednadahlkrtimgrevviaitdrkmdlgpweqvf ygefdgmrpkrvlvkiige
Timeline for d1vmja_: