Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor Xa, protease domain [50574] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50575] (55 PDB entries) Uniprot P00742 235-467 |
Domain d1v3xa_: 1v3x A: [113506] Other proteins in same PDB: d1v3xb_ complexed with ca, d76 |
PDB Entry: 1v3x (more details), 2.2 Å
SCOPe Domain Sequences for d1v3xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3xa_ b.47.1.2 (A:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmk
Timeline for d1v3xa_: