Lineage for d1umka2 (1umk A:154-300)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160530Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1160531Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1160532Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 1160533Protein cytochrome b5 reductase [52357] (3 species)
  7. 1160534Species Human (Homo sapiens) [TaxId:9606] [117484] (1 PDB entry)
    Uniprot P00387 30-300
  8. 1160535Domain d1umka2: 1umk A:154-300 [113313]
    Other proteins in same PDB: d1umka1
    complexed with fad

Details for d1umka2

PDB Entry: 1umk (more details), 1.75 Å

PDB Description: The Structure of Human Erythrocyte NADH-cytochrome b5 Reductase
PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1umka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]}
gkfairpdkksnpiirtvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnkhsarfklwytldrapeawdygqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnldhvghptercfvf

SCOPe Domain Coordinates for d1umka2:

Click to download the PDB-style file with coordinates for d1umka2.
(The format of our PDB-style files is described here.)

Timeline for d1umka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1umka1