Class g: Small proteins [56992] (85 folds) |
Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
Superfamily g.16.2: Plexin repeat [103575] (1 family) |
Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
Protein Integrin beta-3 [118249] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries) |
Domain d1u8cb6: 1u8c B:1001-1057 [113125] Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5 complexed with ca, nag |
PDB Entry: 1u8c (more details), 3.1 Å
SCOP Domain Sequences for d1u8cb6:
Sequence, based on SEQRES records: (download)
>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp
>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncaiefp
Timeline for d1u8cb6: