SCOP 1.73: Domain d1u8cb6: 1u8c B:1001-1057

Lineage for d1u8cb6 (1u8c B:1001-1057)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
   disulfide-rich fold; common core is alpha+beta with two conserved disulfides

4. Superfamily g.16.2: Plexin repeat [103575] (1 family)

5. Family g.16.2.1: Plexin repeat [103576] (3 proteins)
   Pfam PF01437

6. Protein Integrin beta-3 [118249] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries)

8. Domain d1u8cb6: 1u8c B:1001-1057 [113125]
   Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5
   complexed with ca, nag

Details for d1u8cb6

PDB Entry: 1u8c, 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure

PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1u8cb6:

Sequence, based on SEQRES records:

>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

Sequence, based on observed residues (ATOM records):

>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncaiefp

Timeline for d1u8cb6:

• d1u8cb6 first appeared in SCOP 1.71
  
• d1u8cb6 appears in SCOP 1.75
  
• d1u8cb6 appears in the current release, SCOPe 2.08