Lineage for d1u8ca1 (1u8c A:439-598)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658523Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 658524Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 658539Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 658540Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
  8. 658550Domain d1u8ca1: 1u8c A:439-598 [113116]
    Other proteins in same PDB: d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6

Details for d1u8ca1

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (A:) Integrin alpha-V

SCOP Domain Sequences for d1u8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8ca1 b.1.15.1 (A:439-598) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahilldcge

SCOP Domain Coordinates for d1u8ca1:

Click to download the PDB-style file with coordinates for d1u8ca1.
(The format of our PDB-style files is described here.)

Timeline for d1u8ca1: