![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein) |
![]() | Protein Integrin beta EGF-like domains [69941] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries) |
![]() | Domain d1u8cb4: 1u8c B:1532-1562 [113123] Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb6 |
PDB Entry: 1u8c (more details), 3.1 Å
SCOP Domain Sequences for d1u8cb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8cb4 g.3.11.6 (B:1532-1562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} kgemcsghgqcscgdclcdsdwtgyycnctt
Timeline for d1u8cb4: