SCOPe 2.06: Domain d1u7ke_: 1u7k E:

Lineage for d1u7ke_ (1u7k E:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein AKV capsid [116949] (2 species)

7. Species AKV murine leukemia virus [TaxId:11791] [116950] (1 PDB entry)
   Uniprot P03336 215-345 # fragment of the core shell protein p30 (215-477)

8. Domain d1u7ke_: 1u7k E: [113091]

Details for d1u7ke_

PDB Entry: 1u7k, 1.85 Å

PDB Description: Structure of a hexameric N-terminal domain from murine leukemia virus capsid

PDB Compounds: (E:) gag polyprotein

SCOPe Domain Sequences for d1u7ke_:

Sequence; same for both SEQRES and ATOM records:

>d1u7ke_ a.73.1.1 (E:) AKV capsid {AKV murine leukemia virus [TaxId: 11791]}
plrmggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllagmqnagr

Timeline for d1u7ke_:

• d1u7ke_ first appeared in SCOP 1.71
  
• d1u7ke_ appears in SCOPe 2.05
  
• d1u7ke_ appears in SCOPe 2.07
  
• d1u7ke_ appears in the current release, SCOPe 2.08