Lineage for d1u3va2 (1u3v A:163-338)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826590Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 1826611Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1826716Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 1826721Domain d1u3va2: 1u3v A:163-338 [113010]
    Other proteins in same PDB: d1u3va1, d1u3vb1
    complexed with hpl, nad, po4, zn

Details for d1u3va2

PDB Entry: 1u3v (more details), 1.65 Å

PDB Description: crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-heptylformamide determined to 1.65 angstrom resolution
PDB Compounds: (A:) Alcohol dehydrogenase beta chain

SCOPe Domain Sequences for d1u3va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3va2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

SCOPe Domain Coordinates for d1u3va2:

Click to download the PDB-style file with coordinates for d1u3va2.
(The format of our PDB-style files is described here.)

Timeline for d1u3va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3va1