Lineage for d1u0wc1 (1u0w C:10-234)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1186520Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1186521Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1186917Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 1186954Protein Chalcone synthase [53915] (1 species)
  7. 1186955Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
    Uniprot P30074
  8. 1187000Domain d1u0wc1: 1u0w C:10-234 [112942]
    complexed with stl

Details for d1u0wc1

PDB Entry: 1u0w (more details), 2 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: 18xchs+resveratrol structure
PDB Compounds: (C:) Chalcone synthase 2

SCOPe Domain Sequences for d1u0wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0wc1 c.95.1.2 (C:10-234) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
aqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdksmikrry
mylteeilkenpnvceymapsldarqamlamevprlgkeaavkaikewgqpkskithliv
cstttpdlpgadyqltkllglrpyvkrvgvfqhgcfaggtvlrlakdlaennkgarvlvv
csevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiek

SCOPe Domain Coordinates for d1u0wc1:

Click to download the PDB-style file with coordinates for d1u0wc1.
(The format of our PDB-style files is described here.)

Timeline for d1u0wc1: