Lineage for d1twhe2 (1twh E:144-215)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606031Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 606032Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 606033Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 606034Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 606035Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (10 PDB entries)
  8. 606043Domain d1twhe2: 1twh E:144-215 [112756]
    Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhj_, d1twhk_, d1twhl_
    complexed with atp, mn, zn

Details for d1twhe2

PDB Entry: 1twh (more details), 3.4 Å

PDB Description: RNA polymerase II complexed with 2'dATP

SCOP Domain Sequences for d1twhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twhe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d1twhe2:

Click to download the PDB-style file with coordinates for d1twhe2.
(The format of our PDB-style files is described here.)

Timeline for d1twhe2: