Class g: Small proteins [56992] (79 folds) |
Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (4 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (9 PDB entries) |
Domain d1twhi2: 1twh I:50-121 [112760] Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhj_, d1twhk_, d1twhl_ complexed with atp, mn, zn |
PDB Entry: 1twh (more details), 3.4 Å
SCOP Domain Sequences for d1twhi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twhi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)} tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi ftsdqknkrtqf
Timeline for d1twhi2: