Lineage for d1twgk_ (1twg K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564986Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2564996Protein RPB11 [64312] (2 species)
  7. 2564997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 2565006Domain d1twgk_: 1twg K: [112749]
    Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgl_
    protein/RNA complex; complexed with ctp, mn, zn

Details for d1twgk_

PDB Entry: 1twg (more details), 3.3 Å

PDB Description: RNA polymerase II complexed with CTP
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d1twgk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twgk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d1twgk_:

Click to download the PDB-style file with coordinates for d1twgk_.
(The format of our PDB-style files is described here.)

Timeline for d1twgk_: