Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
Domain d1twgi1: 1twg I:1-49 [112746] Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgj_, d1twgk_, d1twgl_ protein/RNA complex; complexed with ctp, mn, zn |
PDB Entry: 1twg (more details), 3.3 Å
SCOPe Domain Sequences for d1twgi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twgi1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d1twgi1: