Lineage for d1twgj_ (1twg J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723657Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1723658Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1723659Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 1723660Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1723671Domain d1twgj_: 1twg J: [112748]
    Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgk_, d1twgl_
    protein/RNA complex; complexed with ctp, mn, zn

Details for d1twgj_

PDB Entry: 1twg (more details), 3.3 Å

PDB Description: RNA polymerase II complexed with CTP
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

SCOPe Domain Sequences for d1twgj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twgj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lryn

SCOPe Domain Coordinates for d1twgj_:

Click to download the PDB-style file with coordinates for d1twgj_.
(The format of our PDB-style files is described here.)

Timeline for d1twgj_: