Lineage for d1twai2 (1twa I:50-121)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705857Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1705858Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)
  6. 1705859Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 1705860Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 1705874Domain d1twai2: 1twa I:50-121 [112705]
    Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae1, d1twae2, d1twaf_, d1twah_, d1twaj_, d1twak_, d1twal_
    protein/RNA complex; complexed with atp, mn, zn

Details for d1twai2

PDB Entry: 1twa (more details), 3.2 Å

PDB Description: RNA polymerase II complexed with ATP
PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOPe Domain Sequences for d1twai2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twai2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqf

SCOPe Domain Coordinates for d1twai2:

Click to download the PDB-style file with coordinates for d1twai2.
(The format of our PDB-style files is described here.)

Timeline for d1twai2: