![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins) |
![]() | Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
![]() | Domain d1twai1: 1twa I:1-49 [112704] Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae1, d1twae2, d1twaf_, d1twah_, d1twaj_, d1twak_, d1twal_ protein/RNA complex; complexed with atp, mn, zn |
PDB Entry: 1twa (more details), 3.2 Å
SCOPe Domain Sequences for d1twai1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twai1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d1twai1: