Lineage for d1tvia_ (1tvi A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571459Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins)
    Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site
  6. 2571463Protein Hypothetical protein TM1509 [118050] (1 species)
  7. 2571464Species Thermotoga maritima [TaxId:2336] [118051] (1 PDB entry)
    Uniprot Q9X1J7
  8. 2571465Domain d1tvia_: 1tvi A: [112684]
    Structural genomics target

Details for d1tvia_

PDB Entry: 1tvi (more details)

PDB Description: solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein
PDB Compounds: (A:) Hypothetical UPF0054 protein TM1509

SCOPe Domain Sequences for d1tvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima [TaxId: 2336]}
mirilgegkgskllenlkekleeivkkeigdvhvnvilvsedeikelnqqfrgqdrptdv
ltfplmeedvygeiyvcpliveenarefnntfekellevvihgilhlagydhefedknsk
emfekqkkyveevwgewrsnpsedsdpgkr

SCOPe Domain Coordinates for d1tvia_:

Click to download the PDB-style file with coordinates for d1tvia_.
(The format of our PDB-style files is described here.)

Timeline for d1tvia_: