Lineage for d1tvia_ (1tvi A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607971Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (3 proteins)
    Pfam 02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site
  6. 607975Protein Hypothetical protein TM1509 [118050] (1 species)
  7. 607976Species Thermotoga maritima [TaxId:243274] [118051] (1 PDB entry)
  8. 607977Domain d1tvia_: 1tvi A: [112684]
    Structural genomics target

Details for d1tvia_

PDB Entry: 1tvi (more details)

PDB Description: solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein

SCOP Domain Sequences for d1tvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima}
mirilgegkgskllenlkekleeivkkeigdvhvnvilvsedeikelnqqfrgqdrptdv
ltfplmeedvygeiyvcpliveenarefnntfekellevvihgilhlagydhefedknsk
emfekqkkyveevwgewrsnpsedsdpgkr

SCOP Domain Coordinates for d1tvia_:

Click to download the PDB-style file with coordinates for d1tvia_.
(The format of our PDB-style files is described here.)

Timeline for d1tvia_: