Lineage for d1tu7a2 (1tu7 A:1-77)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132391Protein Class pi GST [81358] (4 species)
  7. 2132547Species Onchocerca volvulus [TaxId:6282] [117595] (2 PDB entries)
    Uniprot P46427
  8. 2132548Domain d1tu7a2: 1tu7 A:1-77 [112654]
    Other proteins in same PDB: d1tu7a1, d1tu7b1
    complexed with gol, gsh

Details for d1tu7a2

PDB Entry: 1tu7 (more details), 1.5 Å

PDB Description: structure of onchocerca volvulus pi-class glutathione s-transferase
PDB Compounds: (A:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tu7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
msykltyfsirglaepirlflvdqdikfiddriakddfssiksqfqfgqlpclydgdqqi
vqsgailrhlarkynln

SCOPe Domain Coordinates for d1tu7a2:

Click to download the PDB-style file with coordinates for d1tu7a2.
(The format of our PDB-style files is described here.)

Timeline for d1tu7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tu7a1