Lineage for d1tpya_ (1tpy A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1378922Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 1378938Protein Methoxy mycolic acid synthase 2, Mma2 [117681] (1 species)
  7. 1378939Species Mycobacterium tuberculosis [TaxId:1773] [117682] (1 PDB entry)
    Uniprot P72026 33-317
  8. 1378940Domain d1tpya_: 1tpy A: [112608]
    complexed with 16a, co3, sah

Details for d1tpya_

PDB Entry: 1tpy (more details), 2.2 Å

PDB Description: Structure of the cyclopropane synthase MmaA2 from Mycobacterium tuberculosis
PDB Compounds: (A:) methoxy mycolic acid synthase 2

SCOPe Domain Sequences for d1tpya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpya_ c.66.1.18 (A:) Methoxy mycolic acid synthase 2, Mma2 {Mycobacterium tuberculosis [TaxId: 1773]}
ndltphfedvqahydlsddffrlfldptqtyscahferedmtleeaqiakidlalgklgl
qpgmtlldigcgwgatmrraiaqydvnvvgltlsknqaahvqksfdemdtprdrrvllag
weqfnepvdrivsigafehfghdrhadffarahkilppdgvlllhtitgltrqqmvdhgl
pltlwlarflkfiateifpggqpptiemveeqsaktgftltrrqslqphyartldlwaea
lqehkseaiaiqseevyerymkyltgcaklfrvgyidvnqftlak

SCOPe Domain Coordinates for d1tpya_:

Click to download the PDB-style file with coordinates for d1tpya_.
(The format of our PDB-style files is described here.)

Timeline for d1tpya_: