SCOPe 2.08: Domain d1tgrb_: 1tgr B:

Lineage for d1tgrb_ (1tgr B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d1tgrb_: 1tgr B: [112428]
   mini-IGF-IB deletion mutant

Details for d1tgrb_

PDB Entry: 1tgr, 1.42 Å

PDB Description: crystal structure of mini-igf-1(2)

PDB Compounds: (B:) insulin-like growth factor ia

SCOPe Domain Sequences for d1tgrb_:

Sequence; same for both SEQRES and ATOM records:

>d1tgrb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkpkakgivdeccfrscdlrrlemyca

Timeline for d1tgrb_:

• d1tgrb_ first appeared in SCOP 1.71
  
• d1tgrb_ appears in SCOPe 2.07