Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Melibiase [75020] (4 species) |
Species Trichoderma reesei [TaxId:51453] [110300] (2 PDB entries) Uniprot Q92456; Alpha-galactosidase agl1; |
Domain d1t0oa1: 1t0o A:315-417 [112211] Other proteins in same PDB: d1t0oa2 complexed with gal |
PDB Entry: 1t0o (more details), 1.96 Å
SCOPe Domain Sequences for d1t0oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0oa1 b.71.1.1 (A:315-417) Melibiase {Trichoderma reesei [TaxId: 51453]} vygqpatpykwginpdwtfnvtypaefwagpsskghlvlmvntlditatkeakwneipgl saghyevrdvwsdkdlgclssykaavaahdtavilvgkkcqrw
Timeline for d1t0oa1: