SCOPe 2.01: Domain d1sz6a_: 1sz6 A:

Lineage for d1sz6a_ (1sz6 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Mistletoe lectin I A-chain [56381] (1 species)

7. Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries)
   different sequence variants
   Uniprot P81446 1-249
   Uniprot Q6ITZ3 1-240

8. Domain d1sz6a_: 1sz6 A: [112171]
   Other proteins in same PDB: d1sz6b1, d1sz6b2
   complexed with azi, cl, gol, nag, so4

Details for d1sz6a_

PDB Entry: 1sz6, 2.05 Å

PDB Description: mistletoe lectin i from viscum album. crystal structure at 2.05 a resolution

PDB Compounds: (A:) rRNA n-glycosidase a chain

SCOPe Domain Sequences for d1sz6a_:

Sequence; same for both SEQRES and ATOM records:

>d1sz6a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn
aggdsitaaidvtnlyvvayqagqqsyflkdapagaetqdfagttrsslpfngsypdler
yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalppgnvvtltnirdviasl
aimlfvcge

Timeline for d1sz6a_:

• d1sz6a_ first appeared in SCOP 1.71
  
• d1sz6a_ appears in SCOP 1.75
  
• d1sz6a_ appears in SCOPe 2.02
  
• d1sz6a_ appears in the current release, SCOPe 2.08