Lineage for d1svlb_ (1svl B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990157Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 990371Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 990372Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
    Uniprot P03070 265-627
  8. 990380Domain d1svlb_: 1svl B: [112124]
    complexed with adp, mg, zn

Details for d1svlb_

PDB Entry: 1svl (more details), 1.95 Å

PDB Description: Co-crystal structure of SV40 large T antigen helicase domain and ADP
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d1svlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svlb_ c.37.1.20 (B:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOPe Domain Coordinates for d1svlb_:

Click to download the PDB-style file with coordinates for d1svlb_.
(The format of our PDB-style files is described here.)

Timeline for d1svlb_: