Lineage for d1rtka2 (1rtk A:243-452)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175419Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1175420Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1175421Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1175427Protein Complement factor B domain [102541] (1 species)
  7. 1175428Species Human (Homo sapiens) [TaxId:9606] [102542] (5 PDB entries)
    Uniprot P00751 268-764
  8. 1175432Domain d1rtka2: 1rtk A:243-452 [111933]
    Other proteins in same PDB: d1rtka1
    complexed with gbs, iod, mg, na

Details for d1rtka2

PDB Entry: 1rtk (more details), 2.3 Å

PDB Description: crystal structure analysis of the bb segment of factor b complexed with 4-guanidinobenzoic acid
PDB Compounds: (A:) complement factor b

SCOPe Domain Sequences for d1rtka2:

Sequence, based on SEQRES records: (download)

>d1rtka2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpddvppegwnrtrhviilm
tdglhnmggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkd
neqhvckvkdmecledvfyqmidesqslsl

Sequence, based on observed residues (ATOM records): (download)

>d1rtka2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpgwnrtrhviilmtdglhn
mggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkdneqhvc
kvkdmecledvfyqmidesqslsl

SCOPe Domain Coordinates for d1rtka2:

Click to download the PDB-style file with coordinates for d1rtka2.
(The format of our PDB-style files is described here.)

Timeline for d1rtka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rtka1