SCOPe 2.05: Domain d1x94a_: 1x94 A:

Lineage for d1x94a_ (1x94 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
   dimer of mono-domain subunits

6. Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)

7. Species Vibrio cholerae [TaxId:666] [110725] (1 PDB entry)
   Uniprot Q9KPY2

8. Domain d1x94a_: 1x94 A: [109522]
   Structural genomics target

Details for d1x94a_

PDB Entry: 1x94, 2.5 Å

PDB Description: crystal structure of a hypothetical protein

PDB Compounds: (A:) putative Phosphoheptose isomerase

SCOPe Domain Sequences for d1x94a_:

Sequence, based on SEQRES records:

>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]}
myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
hfaeeltgryrenrpgypgiaisdpshlscvsndfgydyvfsryveavgakgdvlfglst
sgnsgnilkaieaakakgmktialtgkdggkmagladveirvphfgyadriqevhikiih
iiiqliekema

Sequence, based on observed residues (ATOM records):

>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]}
myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
hfaeeltgryrenrpgypgiaidyvfsryveavgakgdvlfglstsgnsgnilkaieaak
akgmktialtgkdggkmagladveirvphfgyadriqevhikiihiiiqliekema

Timeline for d1x94a_:

• d1x94a_ first appeared in SCOP 1.69
  
• d1x94a_ appears in SCOPe 2.04
  
• d1x94a_ appears in SCOPe 2.06
  
• d1x94a_ appears in the current release, SCOPe 2.08