Lineage for d1x86g2 (1x86 G:1020-1133)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957216Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 957388Protein Rho guanine nucleotide exchange factor 12 [110270] (1 species)
  7. 957389Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110271] (2 PDB entries)
    Uniprot Q9NZN5 766-1138
  8. 957394Domain d1x86g2: 1x86 G:1020-1133 [109514]
    Other proteins in same PDB: d1x86a1, d1x86b_, d1x86c1, d1x86d_, d1x86e1, d1x86f_, d1x86g1, d1x86h_
    complexed with po4

Details for d1x86g2

PDB Entry: 1x86 (more details), 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
PDB Compounds: (G:) Rho guanine nucleotide exchange factor 12

SCOPe Domain Sequences for d1x86g2:

Sequence, based on SEQRES records: (download)

>d1x86g2 b.55.1.1 (G:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrchskilastadskhtfspv
iklstvlvrqvatdnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

Sequence, based on observed residues (ATOM records): (download)

>d1x86g2 b.55.1.1 (G:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
mihegplvwdlytllledilvllqkqddrlvviklstvlvrqvatdnkalfvisqiyelv
aqtvsektvwqdlicrmaas

SCOPe Domain Coordinates for d1x86g2:

Click to download the PDB-style file with coordinates for d1x86g2.
(The format of our PDB-style files is described here.)

Timeline for d1x86g2: