Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Pentaerythritol tetranirate reductase [63900] (1 species) |
Species Enterobacter cloacae [TaxId:550] [63901] (29 PDB entries) Uniprot P71278 |
Domain d1vysx_: 1vys X: [108907] complexed with fmn, tnf; mutant |
PDB Entry: 1vys (more details), 1.8 Å
SCOPe Domain Sequences for d1vysx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vysx_ c.1.4.1 (X:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq isaqakgyagapglhspeqiaawkkitagvhaedgriavqlyhtgrishssiqpggqapv sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd ypsl
Timeline for d1vysx_: