Lineage for d1vysx_ (1vys X:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473648Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 473649Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)
  6. 473793Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 473794Species Enterobacter cloacae [TaxId:550] [63901] (13 PDB entries)
  8. 473805Domain d1vysx_: 1vys X: [108907]

Details for d1vysx_

PDB Entry: 1vys (more details), 1.8 Å

PDB Description: structure of pentaerythritol tetranitrate reductase w102y mutant and complexed with picric acid

SCOP Domain Sequences for d1vysx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vysx_ c.1.4.1 (X:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlyhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl

SCOP Domain Coordinates for d1vysx_:

Click to download the PDB-style file with coordinates for d1vysx_.
(The format of our PDB-style files is described here.)

Timeline for d1vysx_: