Lineage for d1vmda1 (1vmd A:12-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859610Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2859611Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 2859640Species Thermotoga maritima [TaxId:2336] [110489] (1 PDB entry)
    Uniprot Q9X0R7 #
  8. 2859641Domain d1vmda1: 1vmd A:12-160 [108891]
    Other proteins in same PDB: d1vmda2, d1vmdb2
    Structural genomics target
    complexed with cl, so4

Details for d1vmda1

PDB Entry: 1vmd (more details), 2.06 Å

PDB Description: Crystal structure of Methylglyoxal synthase (TM1185) from Thermotoga maritima at 2.06 A resolution
PDB Compounds: (A:) methylglyoxal synthase

SCOPe Domain Sequences for d1vmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmda1 c.24.1.2 (A:12-160) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]}
mdkkkrialiahdrrkrdllewvsfnlgtlskhelyatgttgallqeklglkvhrlksgp
lggdqqigamiaegkidvliffwdplepqahdvdvkaliriatvynipvaitrstadfli
ssplmndvyekiqidyeeelerrirkvve

SCOPe Domain Coordinates for d1vmda1:

Click to download the PDB-style file with coordinates for d1vmda1.
(The format of our PDB-style files is described here.)

Timeline for d1vmda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vmda2