Lineage for d1vllb_ (1vll B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106786Family c.2.1.13: Ornithine cyclodeaminase-like [110436] (2 proteins)
    Pfam PF02423; contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet
  6. 2106787Protein Archaeal alanine dehydrogenase [110437] (1 species)
  7. 2106788Species Archaeoglobus fulgidus [TaxId:2234] [110438] (2 PDB entries)
    Uniprot O28608 # Rossmann-fold core (101-292) begins with an N-terminal helix and ends with a beta-strand
  8. 2106792Domain d1vllb_: 1vll B: [108835]
    Structural genomics target

Details for d1vllb_

PDB Entry: 1vll (more details), 2.8 Å

PDB Description: Crystal structure of alanine dehydrogenase (AF1665) from Archaeoglobus fulgidus at 2.80 A resolution
PDB Compounds: (B:) alanine dehydrogenase

SCOPe Domain Sequences for d1vllb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vllb_ c.2.1.13 (B:) Archaeal alanine dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
akvvyenalsknvgskikffr

SCOPe Domain Coordinates for d1vllb_:

Click to download the PDB-style file with coordinates for d1vllb_.
(The format of our PDB-style files is described here.)

Timeline for d1vllb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vlla_