Lineage for d1vg9a2 (1vg9 A:445-557)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895243Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1895244Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1895633Family d.16.1.6: GDI-like [54399] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 1895642Protein Rab escort protein 1 [89845] (1 species)
  7. 1895643Species Norway rat (Rattus norvegicus) [TaxId:10116] [89846] (3 PDB entries)
    Uniprot P37727
  8. 1895645Domain d1vg9a2: 1vg9 A:445-557 [108611]
    Other proteins in same PDB: d1vg9a1, d1vg9b_, d1vg9c1, d1vg9d_, d1vg9e1, d1vg9f_, d1vg9g1, d1vg9h_
    complexed with gdp, k, mg, p33

Details for d1vg9a2

PDB Entry: 1vg9 (more details), 2.5 Å

PDB Description: the crystal structures of the rep-1 protein in complex with c- terminally truncated rab7 protein
PDB Compounds: (A:) Rab proteins geranylgeranyltransferase component A 1

SCOPe Domain Sequences for d1vg9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg9a2 d.16.1.6 (A:445-557) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qyrqisravlitdgsvlrtdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh
ltcmssktaredlervvqklftpyteieaeneqvekprllwalyfnmrdssdi

SCOPe Domain Coordinates for d1vg9a2:

Click to download the PDB-style file with coordinates for d1vg9a2.
(The format of our PDB-style files is described here.)

Timeline for d1vg9a2: