Lineage for d1vcwb1 (1vcw B:255-353)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056808Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 2056852Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)
  7. 2056853Species Escherichia coli [TaxId:562] [110189] (6 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2056868Domain d1vcwb1: 1vcw B:255-353 [108512]
    Other proteins in same PDB: d1vcwa2, d1vcwb2, d1vcwc2

Details for d1vcwb1

PDB Entry: 1vcw (more details), 3.05 Å

PDB Description: Crystal structure of DegS after backsoaking the activating peptide
PDB Compounds: (B:) Protease degS

SCOPe Domain Sequences for d1vcwb1:

Sequence, based on SEQRES records: (download)

>d1vcwb1 b.36.1.4 (B:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypa

Sequence, based on observed residues (ATOM records): (download)

>d1vcwb1 b.36.1.4 (B:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggrgivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsv
ipvvvqltlqvtiqeypa

SCOPe Domain Coordinates for d1vcwb1:

Click to download the PDB-style file with coordinates for d1vcwb1.
(The format of our PDB-style files is described here.)

Timeline for d1vcwb1: