Lineage for d1vaea_ (1vae A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122539Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1122709Protein Rhophilin-2 [110184] (1 species)
  7. 1122710Species Mouse (Mus musculus) [TaxId:10090] [110185] (1 PDB entry)
    Uniprot Q8BWR8 506-603
  8. 1122711Domain d1vaea_: 1vae A: [108466]
    Structural genomics target

Details for d1vaea_

PDB Entry: 1vae (more details)

PDB Description: solution structure of the pdz domain of mouse rhophilin-2
PDB Compounds: (A:) rhophilin, Rho GTPase binding protein 2

SCOPe Domain Sequences for d1vaea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgsaskrwspprgihftveegdlgftlrgntpvqvhfldphcsaslagakegdyi
vsiqgvdckwltvsevmkllksfggeevemkvvslldstssmhnksgpssg

SCOPe Domain Coordinates for d1vaea_:

Click to download the PDB-style file with coordinates for d1vaea_.
(The format of our PDB-style files is described here.)

Timeline for d1vaea_: