SCOPe 2.08: Domain d1v9yb_: 1v9y B:

Lineage for d1v9yb_ (1v9y B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)

6. Protein Direct oxygen sensor protein, DOS [111118] (1 species)
   Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU

7. Species Escherichia coli [TaxId:562] [111119] (5 PDB entries)
   Uniprot P76129 8-126 ! Uniprot P76129 12-124

8. Domain d1v9yb_: 1v9y B: [108455]
   complexed with hem

Details for d1v9yb_

PDB Entry: 1v9y, 1.32 Å

PDB Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (ferric form)

PDB Compounds: (B:) Heme pas sensor protein

SCOPe Domain Sequences for d1v9yb_:

Sequence, based on SEQRES records:

>d1v9yb_ d.110.3.2 (B:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrd

Sequence, based on observed residues (ATOM records):

>d1v9yb_ d.110.3.2 (B:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnrerelqlekkdgskiwtrfalskvsaegkvyylalvrd

Timeline for d1v9yb_:

• d1v9yb_ first appeared in SCOP 1.69
  
• d1v9yb_ appears in SCOPe 2.07