Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein hypothetical D7wsu128e protein [110800] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [110801] (1 PDB entry) Uniprot Q78JW9 76-157 |
Domain d1v86a_: 1v86 A: [108421] Structural genomics target |
PDB Entry: 1v86 (more details)
SCOPe Domain Sequences for d1v86a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} gssgssgdagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvm ykglvpedktlreikvtsgakimvvgstisgpssg
Timeline for d1v86a_: