SCOPe 2.02: Domain d1ux9a_: 1ux9 A:

Lineage for d1ux9a_ (1ux9 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Cytoglobin [109626] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109627] (6 PDB entries)
   Uniprot Q8WWM9 18-171

8. Domain d1ux9a_: 1ux9 A: [108089]
   complexed with fc6, hem, xe

Details for d1ux9a_

PDB Entry: 1ux9, 2.4 Å

PDB Description: mapping protein matrix cavities in human cytoglobin through xe atom binding: a crystallographic investigation

PDB Compounds: (A:) cytoglobin

SCOPe Domain Sequences for d1ux9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ux9a_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

Timeline for d1ux9a_:

• d1ux9a_ first appeared in SCOP 1.69
  
• d1ux9a_ appears in SCOPe 2.01
  
• d1ux9a_ appears in SCOPe 2.03
  
• d1ux9a_ appears in the current release, SCOPe 2.08