Lineage for d1uupb1 (1uup B:2001-2107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059173Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 2059174Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 2059182Domain d1uupb1: 1uup B:2001-2107 [108052]
    Other proteins in same PDB: d1uupa2, d1uupb2, d1uupc2, d1uupd2
    complexed with zn

Details for d1uupb1

PDB Entry: 1uup (more details), 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
PDB Compounds: (B:) exotoxin type a

SCOPe Domain Sequences for d1uupb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uupb1 b.40.2.2 (B:2001-2107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1uupb1:

Click to download the PDB-style file with coordinates for d1uupb1.
(The format of our PDB-style files is described here.)

Timeline for d1uupb1: