Lineage for d1uu0c_ (1uu0 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1000625Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1000626Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1000627Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1000873Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 1000881Species Thermotoga maritima [TaxId:2336] [102594] (5 PDB entries)
    Uniprot Q9X0D0
    TM1040
  8. 1000892Domain d1uu0c_: 1uu0 C: [108040]
    complexed with po4

Details for d1uu0c_

PDB Entry: 1uu0 (more details), 2.85 Å

PDB Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form)
PDB Compounds: (C:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d1uu0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uu0c_ c.67.1.1 (C:) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
ktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdflsknnvs
vgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripevnvgegd
vvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyenlavirtf
skafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifeertkfive
erermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfregvritigk
reendmilrele

SCOPe Domain Coordinates for d1uu0c_:

Click to download the PDB-style file with coordinates for d1uu0c_.
(The format of our PDB-style files is described here.)

Timeline for d1uu0c_: