SCOPe 2.02: Domain d1uizc_: 1uiz C:

Lineage for d1uizc_ (1uiz C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [111042] (1 PDB entry)
   Uniprot Q76BK2

8. Domain d1uizc_: 1uiz C: [107886]

Details for d1uizc_

PDB Entry: 1uiz, 2.5 Å

PDB Description: crystal structure of macrophage migration inhibitory factor from xenopus laevis.

PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d1uizc_:

Sequence; same for both SEQRES and ATOM records:

>d1uizc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc
slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa

Timeline for d1uizc_:

• d1uizc_ first appeared in SCOP 1.69
  
• d1uizc_ appears in SCOPe 2.01
  
• d1uizc_ appears in SCOPe 2.03
  
• d1uizc_ appears in the current release, SCOPe 2.08