Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) |
Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins) |
Protein Geminin coiled-coil domain [111471] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [111472] (2 PDB entries) Uniprot O75496 70-152 |
Domain d1uiib_: 1uii B: [107865] |
PDB Entry: 1uii (more details), 2 Å
SCOPe Domain Sequences for d1uiib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uiib_ h.1.28.1 (B:) Geminin coiled-coil domain {Human (Homo sapiens) [TaxId: 9606]} enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym a
Timeline for d1uiib_: