SCOPe 2.06: Domain d1uf7a_: 1uf7 A:

Lineage for d1uf7a_ (1uf7 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families)
   Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases

5. Family d.160.1.2: Carbamilase [64433] (3 proteins)

6. Protein N-carbamoyl-D-aminoacid amidohydrolase [64434] (2 species)

7. Species Agrobacterium sp. [TaxId:361] [64435] (5 PDB entries)
   Uniprot P60327

8. Domain d1uf7a_: 1uf7 A: [107810]
   complexed with cdv; mutant

Details for d1uf7a_

PDB Entry: 1uf7, 1.9 Å

PDB Description: crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine

PDB Compounds: (A:) N-carbamyl-D-amino acid amidohydrolase

SCOPe Domain Sequences for d1uf7a_:

Sequence; same for both SEQRES and ATOM records:

>d1uf7a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp. [TaxId: 361]}
trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
ael

Timeline for d1uf7a_:

• d1uf7a_ first appeared in SCOP 1.69
  
• d1uf7a_ appears in SCOPe 2.05
  
• d1uf7a_ appears in SCOPe 2.07
  
• d1uf7a_ appears in the current release, SCOPe 2.08