Lineage for d1u98a2 (1u98 A:269-328)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904179Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 1904180Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 1904181Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 1904182Protein RecA protein, C-terminal domain [54754] (5 species)
  7. 1904185Species Escherichia coli [TaxId:562] [54755] (9 PDB entries)
    Uniprot P0A7G6 P03017
  8. 1904188Domain d1u98a2: 1u98 A:269-328 [107746]
    Other proteins in same PDB: d1u98a1
    complexed with gol, so4

Details for d1u98a2

PDB Entry: 1u98 (more details), 2 Å

PDB Description: crystal structure of e. coli reca in a compressed helical filament form3
PDB Compounds: (A:) reca protein

SCOPe Domain Sequences for d1u98a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u98a2 d.48.1.1 (A:269-328) RecA protein, C-terminal domain {Escherichia coli [TaxId: 562]}
nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll

SCOPe Domain Coordinates for d1u98a2:

Click to download the PDB-style file with coordinates for d1u98a2.
(The format of our PDB-style files is described here.)

Timeline for d1u98a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u98a1