Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins) duplication: tandem repeat of two "winged-helix" domains |
Protein Vacuolar protein sorting-associated protein VPS36 [109695] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109696] (2 PDB entries) Uniprot Q06696 396-566 |
Domain d1u5tb1: 1u5t B:396-489 [107686] Other proteins in same PDB: d1u5ta1, d1u5ta2, d1u5tc1, d1u5tc2, d1u5td1, d1u5td2 |
PDB Entry: 1u5t (more details), 3.6 Å
SCOPe Domain Sequences for d1u5tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5tb1 a.4.5.54 (B:396-489) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldrekflnkelfldeiareiyeftlsefkdlnsdtnymiitlvdlyamynksmrigtgli spmemreacerfehlglnelklvkvnkrilcvts
Timeline for d1u5tb1: