Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (6 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (6 PDB entries) Uniprot P84229 |
Domain d1tzyc_: 1tzy C: [107532] Other proteins in same PDB: d1tzya_, d1tzyb_, d1tzyd_, d1tzye_, d1tzyf_, d1tzyh_ complexed with cl, po4 |
PDB Entry: 1tzy (more details), 1.9 Å
SCOPe Domain Sequences for d1tzyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl vglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1tzyc_: