SCOPe 2.01: Domain d1txda2: 1txd A:1020-1133

Lineage for d1txda2 (1txd A:1020-1133)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Rho guanine nucleotide exchange factor 12 [110270] (1 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110271] (2 PDB entries)
   Uniprot Q9NZN5 766-1138

8. Domain d1txda2: 1txd A:1020-1133 [107423]
   Other proteins in same PDB: d1txda1

Details for d1txda2

PDB Entry: 1txd, 2.13 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 12

SCOPe Domain Sequences for d1txda2:

Sequence, based on SEQRES records:

>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrchskilastadskhtfspv
iklstvlvrqvatdnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

Sequence, based on observed residues (ATOM records):

>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrctfspviklstvlvrqvat
nkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

Timeline for d1txda2:

• d1txda2 first appeared in SCOP 1.69
  
• d1txda2 appears in SCOP 1.75
  
• d1txda2 appears in SCOPe 2.02
  
• d1txda2 appears in the current release, SCOPe 2.08