![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
![]() | Protein Diaminopimelate decarboxylase LysA [89457] (3 species) most similar to eukaryotic ODC |
![]() | Species Methanococcus jannaschii [TaxId:2190] [110347] (2 PDB entries) Uniprot Q58497 |
![]() | Domain d1twid2: 1twi D:50-313 [107406] Other proteins in same PDB: d1twia1, d1twib1, d1twic1, d1twid1 Structural genomics target complexed with lys, mg, plp |
PDB Entry: 1twi (more details), 2 Å
SCOPe Domain Sequences for d1twid2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twid2 c.1.6.1 (D:50-313) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]} seeqikinynryieafkrweeetgkefivayaykananlaitrllaklgcgadvvsggel yiaklsnvpskkivfngncktkeeiimgieanirafnvdsiselilinetakelgetanv afrinpnvnpkthpkistglkknkfgldvesgiamkaikmalemeyvnvvgvhchigsql tdispfieetrkvmdfvvelkeegieiedvnlggglgipyykdkqiptqkdladaiintm lkykdkvempnlilepgrslvata
Timeline for d1twid2: